PDB entry 1e4w

View 1e4w on RCSB PDB site
Description: crossreactive binding of a circularized peptide to an anti-tgfalpha antibody fab-fragment
Class: immune system
Keywords: immune system, complex (antibody/antigen), cross-reactivity, protein-peptide recognition
Deposited on 2000-07-12, released 2001-07-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.204
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: tab2
    Species: Mus musculus [TaxId:10090]
    Domains in SCOPe 2.06: d1e4wh1, d1e4wh2
  • Chain 'L':
    Compound: tab2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1E4W (0-6)
    Domains in SCOPe 2.06: d1e4wl1, d1e4wl2
  • Chain 'P':
    Compound: cyclic peptide
  • Heterogens: NI, CL, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e4wH (H:)
    qvqlqqpgaelvkpgasvklsckasgftftnywmhwvkqrpgqglewigeilpsngrtny
    nekfktkatltvdkssntaymqlssltsedsavyycarspsdywgqgttltvssakttap
    svyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlss
    svtvtsstwpsqsitcnvahpasstkvdkkiep
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e4wL (L:)
    diqmtqtpsslsaslgdrvtiscrasqdishylnwfqqkpdgtvklliyytstlhsgvps
    rfsgsgsgtdysltisnleeediafyfcqqggalpftfgsgtklaikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvldswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'P':
    No sequence available.