PDB entry 1e4v

View 1e4v on RCSB PDB site
Description: mutant g10v of adenylate kinase from e. coli, modified in the gly-loop
Deposited on 2000-07-12, released 2000-08-04
The last revision prior to the SCOP 1.57 freeze date was dated 2000-08-04, with a file datestamp of 2000-08-04.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.196
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e4vA (A:)
    mriillgapvagkgtqaqfimekygipqistgdmlraavksgselgkqakdimdagklvt
    delvialvkeriaqedcrngflldgfprtipqadamkeaginvdyvlefdvpdelivdri
    vgrrvhapsgrvyhvkfnppkvegkddvtgeelttrkddqeetvrkrlveyhqmtaplig
    yyskeaeagntkyakvdgtkpvaevradlekilg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e4vB (B:)
    mriillgapvagkgtqaqfimekygipqistgdmlraavksgselgkqakdimdagklvt
    delvialvkeriaqedcrngflldgfprtipqadamkeaginvdyvlefdvpdelivdri
    vgrrvhapsgrvyhvkfnppkvegkddvtgeelttrkddqeetvrkrlveyhqmtaplig
    yyskeaeagntkyakvdgtkpvaevradlekilg