PDB entry 1e4s

View 1e4s on RCSB PDB site
Description: solution structure of the human defensin hbd-1
Class: defensin
Keywords: defensin, human, nmr structure
Deposited on 2000-07-12, released 2001-07-12
The last revision prior to the SCOP 1.75 freeze date was dated 2001-11-26, with a file datestamp of 2007-07-20.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-defensin 1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1e4sa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e4sA (A:)
    dhyncvssggqclysacpiftkiqgtcyrgkakcck