PDB entry 1e4r

View 1e4r on RCSB PDB site
Description: solution structure of the mouse defensin mbd-8
Class: defensin
Keywords: defensin, mouse, nmr structure
Deposited on 2000-07-12, released 2001-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-defensin 8
    Species: Mus musculus, synthetic [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e4ra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e4rA (A:)
    nepvscirnggicqyrciglrhkigtcgspfkcck