PDB entry 1e4r

View 1e4r on RCSB PDB site
Description: Solution structure of the mouse defensin mBD-8
Class: defensin
Keywords: defensin, mouse
Deposited on 2000-07-12, released 2001-07-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: beta-defensin 8
  Species: MUS MUSCULUS, synthetic [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q91V82 (0-34)
  Domains in SCOPe 2.08: d1e4ra_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1e4rA (A:)
  nepvscirnggicqyrciglrhkigtcgspfkcck