PDB entry 1e4q

View 1e4q on RCSB PDB site
Description: solution structure of the human defensin hbd-2
Class: defensin
Keywords: defensin, human, nmr structure
Deposited on 2000-07-12, released 2001-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-defensin 2
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e4qa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e4qA (A:)
    pvtclksgaichpvfcprrykqigtcglpgtkcckkp