PDB entry 1e4q

View 1e4q on RCSB PDB site
Description: solution structure of the human defensin hbd-2
Class: defensin
Keywords: defensin, human, nmr structure
Deposited on 2000-07-12, released 2001-07-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: beta-defensin 2
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O15263 (0-36)
  Domains in SCOPe 2.08: d1e4qa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1e4qA (A:)
  pvtclksgaichpvfcprrykqigtcglpgtkcckkp