PDB entry 1e4o

View 1e4o on RCSB PDB site
Description: Phosphorylase recognition and phosphorolysis of its oligosaccharide substrate: answers to a long outstanding question
Class: hydrolase
Keywords: maltopentaose, carbohydrate recognition, phosphorylase, hydrolase, binary and ternary oligosaccharide complexes
Deposited on 2000-07-11, released 2000-08-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.245
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: maltodextrin phosphorylase
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00490 (0-795)
      • conflict (292)
      • conflict (486)
      • conflict (488)
      • conflict (497)
      • conflict (500)
      • conflict (520)
      • conflict (546)
      • conflict (680)
    Domains in SCOPe 2.07: d1e4oa_
  • Chain 'B':
    Compound: maltodextrin phosphorylase
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00490 (0-795)
      • conflict (292)
      • conflict (486)
      • conflict (488)
      • conflict (497)
      • conflict (500)
      • conflict (520)
      • conflict (546)
      • conflict (680)
    Domains in SCOPe 2.07: d1e4ob_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e4oA (A:)
    sqpifndkqfqealsrqwqryglnsaaemtprqwwlavsealaemlraqpfakpvanqrh
    vnyismefligrltgnnllnlgwyqdvqdslkaydinltdlleeeidpalgngglgrlaa
    cfldsmatvgqsatgyglnyqyglfrqsfvdgkqveapddwhrsnypwfrhnealdvqvg
    iggkvtkdgrwepeftitgqawdlpvvgyrngvaqplrlwqathahpfdltkfndgdflr
    aeqqginaekltkvlypndnhtagkklrlmqqyfqcacsvadilrrhhlagrklhelady
    eviqlndthptiaipellrvlidehqmswddawaitsktfaytnhtlmpealerwdvklv
    kgllprhmqiineintrfktlvektwpgdekvwaklavvhdkqvhmanlcvvggfavngv
    aalhsdlvvkdlfpeyhqlwpnkfhnvtngitprrwikqcnpalaalldkslqkewandl
    dqlinlekfaddakfrdqyreikqankvrlaefvkvrtgieinpqaifdiqikrlheykr
    qhlnllhilalykeirenpqadrvprvflfgakaapgyylakniifainkvadvinndpl
    vgdklkvvflpdycvsaaeklipaadiseqistagkeasgtgnmklalngaltvgtldga
    nveiaekvgeenififghtveqvkailakgydpvkwrkkdkvldavlkelesgkysdgdk
    hafdqmlhsigkqggdpylvmadfaayveaqkqvdvlyrdqeawtraailntarcgmfss
    drsirdyqariwqakr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e4oB (B:)
    sqpifndkqfqealsrqwqryglnsaaemtprqwwlavsealaemlraqpfakpvanqrh
    vnyismefligrltgnnllnlgwyqdvqdslkaydinltdlleeeidpalgngglgrlaa
    cfldsmatvgqsatgyglnyqyglfrqsfvdgkqveapddwhrsnypwfrhnealdvqvg
    iggkvtkdgrwepeftitgqawdlpvvgyrngvaqplrlwqathahpfdltkfndgdflr
    aeqqginaekltkvlypndnhtagkklrlmqqyfqcacsvadilrrhhlagrklhelady
    eviqlndthptiaipellrvlidehqmswddawaitsktfaytnhtlmpealerwdvklv
    kgllprhmqiineintrfktlvektwpgdekvwaklavvhdkqvhmanlcvvggfavngv
    aalhsdlvvkdlfpeyhqlwpnkfhnvtngitprrwikqcnpalaalldkslqkewandl
    dqlinlekfaddakfrdqyreikqankvrlaefvkvrtgieinpqaifdiqikrlheykr
    qhlnllhilalykeirenpqadrvprvflfgakaapgyylakniifainkvadvinndpl
    vgdklkvvflpdycvsaaeklipaadiseqistagkeasgtgnmklalngaltvgtldga
    nveiaekvgeenififghtveqvkailakgydpvkwrkkdkvldavlkelesgkysdgdk
    hafdqmlhsigkqggdpylvmadfaayveaqkqvdvlyrdqeawtraailntarcgmfss
    drsirdyqariwqakr