PDB entry 1e4m

View 1e4m on RCSB PDB site
Description: myrosinase from sinapis alba
Class: hydrolase
Keywords: hydrolase, family 1 glycosyl hydrolase, glucosinolate, tim barrel
Deposited on 2000-07-10, released 2001-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-09, with a file datestamp of 2011-11-04.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.124
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'M':
    Compound: myrosinase ma1
    Species: SINAPIS ALBA [TaxId:3728]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e4mm_
  • Heterogens: NAG, ZN, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1e4mM (M:)
    deeitcqenlpftcgntdalnsssfssdfifgvassayqiegtigrglniwdgfthrypn
    ksgpdhgngdttcdsfsywqkdidvldelnatgyrfsiawsriiprgkrsrgvnekgidy
    yhglisglikkgitpfvtlfhwdlpqtlqdeyegfldpqiiddfkdyadlcfeefgdsvk
    ywltinqlysvptrgygsaldapgrcsptvdpscyagnsstepyivahhqllahakvvdl
    yrknythqggkigptmitrwflpyndtdrhsiaatermkefflgwfmgpltngtypqimi
    dtvgerlpsfspeesnlvkgsydflglnyyftqyaqpspnpvnstnhtammdagakltyi
    nasghyigplfekdkadstdniyyypkgiysvmdyfknkyynpliyvtengistpgdenr
    nqsmldytridylcshlcflnkvikekdvnvkgylawalgdnyefnkgftvrfglsyidw
    nnvtdrdlkksgqwyqsfisp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e4mM (M:)
    eitcqenlpftcgntdalnsssfssdfifgvassayqiegtigrglniwdgfthrypnks
    gpdhgngdttcdsfsywqkdidvldelnatgyrfsiawsriiprgkrsrgvnekgidyyh
    glisglikkgitpfvtlfhwdlpqtlqdeyegfldpqiiddfkdyadlcfeefgdsvkyw
    ltinqlysvptrgygsaldapgrcsptvdpscyagnsstepyivahhqllahakvvdlyr
    knythqggkigptmitrwflpyndtdrhsiaatermkefflgwfmgpltngtypqimidt
    vgerlpsfspeesnlvkgsydflglnyyftqyaqpspnpvnstnhtammdagakltyina
    sghyigplfekdkadstdniyyypkgiysvmdyfknkyynpliyvtengistpgdenrnq
    smldytridylcshlcflnkvikekdvnvkgylawalgdnyefnkgftvrfglsyidwnn
    vtdrdlkksgqwyqsfisp