PDB entry 1e4l

View 1e4l on RCSB PDB site
Description: crystal structure of the inactive mutant monocot (maize zmglu1) beta-glucosidase zm glu191asp
Class: hydrolase
Keywords: glycoside hydrolase, hydrolase, family 1, retention of the anomeric configuration, inactive mutant e191d
Deposited on 2000-07-10, released 2000-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.207
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-glucosidase, chloroplastic
    Species: ZEA MAYS [TaxId:4577]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49235
      • engineered mutation (190)
    Domains in SCOPe 2.07: d1e4la_
  • Chain 'B':
    Compound: beta-glucosidase, chloroplastic
    Species: ZEA MAYS [TaxId:4577]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49235
      • engineered mutation (190)
    Domains in SCOPe 2.07: d1e4lb_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e4lA (A:)
    sarvgsqngvqmlspseipqrdwfpsdftfgaatsayqiegawnedgkgesnwdhfchnh
    perildgsnsdigansyhmyktdvrllkemgmdayrfsiswprilpkgtkegginpdgik
    yyrnlinlllengiepyvtifhwdvpqaleekyggfldkshksivedytyfakvcfdnfg
    dkvknwltfndpqtftsfsygtgvfapgrcspgldcayptgnslvepytaghnillahae
    avdlynkhykrddtriglafdvmgrvpygtsfldkqaeerswdinlgwflepvvrgdypf
    smrslarerlpffkdeqkeklagsynmlglnyytsrfsknidispnyspvlntddayasq
    evngpdgkpigppmgnpwiymypeglkdllmimknkygnppiyitengigdvdtketplp
    meaalndykrldyiqrhiatlkesidlgsnvqgyfawslldnfewfagfterygivyvdr
    nnnctrymkesakwlkefntakkpskkiltpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e4lA (A:)
    mlspseipqrdwfpsdftfgaatsayqiegawnedgkgesnwdhfchnhperildgsnsd
    igansyhmyktdvrllkemgmdayrfsiswprilpkgtkegginpdgikyyrnlinllle
    ngiepyvtifhwdvpqaleekyggfldkshksivedytyfakvcfdnfgdkvknwltfnd
    pqtftsfsygtgvfapgrcspgldcayptgnslvepytaghnillahaeavdlynkhykr
    ddtriglafdvmgrvpygtsfldkqaeerswdinlgwflepvvrgdypfsmrslarerlp
    ffkdeqkeklagsynmlglnyytsrfsknidispnyspvlntddayasqevngpdgkpig
    ppmgnpwiymypeglkdllmimknkygnppiyitengigdvdtketplpmeaalndykrl
    dyiqrhiatlkesidlgsnvqgyfawslldnfewfagfterygivyvdrnnnctrymkes
    akwlkefnta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e4lB (B:)
    sarvgsqngvqmlspseipqrdwfpsdftfgaatsayqiegawnedgkgesnwdhfchnh
    perildgsnsdigansyhmyktdvrllkemgmdayrfsiswprilpkgtkegginpdgik
    yyrnlinlllengiepyvtifhwdvpqaleekyggfldkshksivedytyfakvcfdnfg
    dkvknwltfndpqtftsfsygtgvfapgrcspgldcayptgnslvepytaghnillahae
    avdlynkhykrddtriglafdvmgrvpygtsfldkqaeerswdinlgwflepvvrgdypf
    smrslarerlpffkdeqkeklagsynmlglnyytsrfsknidispnyspvlntddayasq
    evngpdgkpigppmgnpwiymypeglkdllmimknkygnppiyitengigdvdtketplp
    meaalndykrldyiqrhiatlkesidlgsnvqgyfawslldnfewfagfterygivyvdr
    nnnctrymkesakwlkefntakkpskkiltpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e4lB (B:)
    mlspseipqrdwfpsdftfgaatsayqiegawnedgkgesnwdhfchnhperildgsnsd
    igansyhmyktdvrllkemgmdayrfsiswprilpkgtkegginpdgikyyrnlinllle
    ngiepyvtifhwdvpqaleekyggfldkshksivedytyfakvcfdnfgdkvknwltfnd
    pqtftsfsygtgvfapgrcspgldcayptgnslvepytaghnillahaeavdlynkhykr
    ddtriglafdvmgrvpygtsfldkqaeerswdinlgwflepvvrgdypfsmrslarerlp
    ffkdeqkeklagsynmlglnyytsrfsknidispnyspvlntddayasqevngpdgkpig
    ppmgnpwiymypeglkdllmimknkygnppiyitengigdvdtketplpmeaalndykrl
    dyiqrhiatlkesidlgsnvqgyfawslldnfewfagfterygivyvdrnnnctrymkes
    akwlkefnta