PDB entry 1e4k

View 1e4k on RCSB PDB site
Description: crystal structure of soluble human igg1 fc fragment-fc-gamma receptor III complex
Class: immune system
Keywords: immune system, fc fragment, igg, receptor,
Deposited on 2000-07-07, released 2000-08-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-10-19, with a file datestamp of 2011-10-14.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.2708
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fc fragment of human igg1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1e4ka1, d1e4ka2
  • Chain 'B':
    Compound: fc fragment of human igg1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1e4kb1, d1e4kb2
  • Chain 'C':
    Compound: low affinity immunoglobulin gamma fc receptor III
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1e4kc1, d1e4kc2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e4kA (A:)
    thtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgv
    qvhnaktkpreqqynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgq
    prepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdg
    sfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e4kA (A:)
    cpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnak
    tkpreqqynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqprepqv
    ytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflys
    kltvdksrwqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e4kB (B:)
    thtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgv
    qvhnaktkpreqqynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgq
    prepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdg
    sfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e4kB (B:)
    cpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnak
    tkpreqqynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqprepqv
    ytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflys
    kltvdksrwqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1e4kC (C:)
    mrtedlpkavvflepqwysvlekdsvtlkcqgayspednstqwfhneslissqassyfid
    aatvndsgeyrcqtnlstlsdpvqlevhigwlllqaprwvfkeedpihlrchswkntalh
    kvtylqngkdrkyfhhnsdfhipkatlkdsgsyfcrglvgsknvssetvnititqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e4kC (C:)
    dlpkavvflepqwysvlekdsvtlkcqgayspednstqwfhneslissqassyfidaatv
    ndsgeyrcqtnlstlsdpvqlevhigwlllqaprwvfkeedpihlrchswkntalhkvty
    lqngkdrkyfhhnsdfhipkatlkdsgsyfcrglvgsknvssetvnititqg