PDB entry 1e4k

View 1e4k on RCSB PDB site
Description:
Deposited on 2000-07-07, released 2000-08-06
The last revision prior to the SCOP 1.55 freeze date was dated 2000-08-06, with a file datestamp of 2000-08-06.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.2708
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1e4ka1, d1e4ka2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1e4kb1, d1e4kb2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1e4kc1, d1e4kc2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e4kA (A:)
    cpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnak
    tkpreqqynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqprepqv
    ytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflys
    kltvdksrwqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e4kB (B:)
    cpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnak
    tkpreqqynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqprepqv
    ytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflys
    kltvdksrwqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e4kC (C:)
    dlpkavvflepqwysvlekdsvtlkcqgayspednstqwfhneslissqassyfidaatv
    ndsgeyrcqtnlstlsdpvqlevhigwlllqaprwvfkeedpihlrchswkntalhkvty
    lqngkdrkyfhhnsdfhipkatlkdsgsyfcrglvgsknvssetvnititqg