PDB entry 1e4j

View 1e4j on RCSB PDB site
Description: crystal structure of the soluble human fc-gamma receptor III
Class: immune system
Keywords: immune system, igg, fc, receptor, cd16, gamma
Deposited on 2000-07-07, released 2000-08-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.1951
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: low affinity immunoglobulin gamma fc receptor III
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e4ja1, d1e4ja2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e4jA (A:)
    mrtedlpkavvflepqwysvlekdsvtlkcqgayspednstqwfhneslissqassyfid
    aatvndsgeyrcqtnlstlsdpvqlevhigwlllqaprwvfkeedpihlrchswkntalh
    kvtylqngkdrkyfhhnsdfhipkatlkdsgsyfcrglvgsknvssetvnititqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e4jA (A:)
    lpkavvflepqwysvlekdsvtlkcqgayspednstqwfhneslissqassyfidaatvn
    dsgeyrcqtnlstlsdpvqlevhigwlllqaprwvfkeedpihlrchswkntalhkvtyl
    qngkdrkyfhhnsdfhipkatlkdsgsyfcrglvgsknvssetvnititqg