PDB entry 1e4i

View 1e4i on RCSB PDB site
Description: 2-deoxy-2-fluoro-beta-d-glucosyl/enzyme intermediate complex of the beta-glucosidase from bacillus polymyxa
Deposited on 2000-07-06, released 2001-07-05
The last revision prior to the SCOP 1.65 freeze date was dated 2001-07-05, with a file datestamp of 2001-07-05.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.21
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1e4ia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e4iA (A:)
    tifqfpqdfmwgtataayqiegayqedgrglsiwdtfahtpgkvfngdngnvacdsyhry
    eedirlmkelgirtyrfsvswprifpngdgevnqkgldyyhrvvdllndngiepfctlyh
    wdlpqalqdaggwgnrrtiqafvqfaetmfrefhgkiqhwltfnepwciaflsnmlgvha
    pgltnlqtaidvghhllvahglsvrrfrelgtsgqigiapnvswavpystseedkaacar
    tislhsdwflqpiyqgsypqflvdwfaeqgatvpiqdgdmdiigepidmiginyysmsvn
    rfnpeagflqseeinmglpvtdigwpvesrglyevlhylqkygnidiyitengacindev
    vngkvqddrrisymqqhlvqvhrtihdglhvkgymawslldnfewaegynmrfgmihvdf
    rtqvrtpkqsyywyrnvvsnnwletrr