PDB entry 1e4d

View 1e4d on RCSB PDB site
Description: structure of oxa10 beta-lactamase at ph 8.3
Class: beta-lactamase
Keywords: beta-lactamase, antiobitic resistance
Deposited on 2000-07-03, released 2001-01-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.19831
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-lactamase oxa-10
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14489
      • modified residue (49)
    Domains in SCOPe 2.07: d1e4da_
  • Chain 'B':
    Compound: beta-lactamase oxa-10
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14489 (0-End)
      • modified residue (49)
    Domains in SCOPe 2.07: d1e4db_
  • Chain 'C':
    Compound: beta-lactamase oxa-10
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14489 (0-245)
      • modified residue (49)
    Domains in SCOPe 2.07: d1e4dc_
  • Chain 'D':
    Compound: beta-lactamase oxa-10
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14489 (0-245)
      • modified residue (49)
    Domains in SCOPe 2.07: d1e4dd_
  • Heterogens: SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e4dA (A:)
    sitentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiiglet
    gviknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkfs
    ygnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaapey
    lvhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkimes
    egiigg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e4dA (A:)
    itentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiigletg
    viknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkfsy
    gnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaapeyl
    vhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkimese
    gii
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e4dB (B:)
    sitentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiiglet
    gviknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkfs
    ygnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaapey
    lvhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkimes
    egiigg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e4dB (B:)
    sitentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiiglet
    gviknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkfs
    ygnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaapey
    lvhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkimes
    egii
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e4dC (C:)
    sitentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiiglet
    gviknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkfs
    ygnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaapey
    lvhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkimes
    egiigg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e4dD (D:)
    sitentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiiglet
    gviknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkfs
    ygnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaapey
    lvhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkimes
    egiigg