PDB entry 1e4b

View 1e4b on RCSB PDB site
Description: l-fuculose 1-phosphate aldolase from escherichia coli mutant n29q
Deposited on 2000-06-30, released 2000-11-06
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-06, with a file datestamp of 2000-11-06.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.165
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Domains in SCOP 1.55: d1e4bp_

PDB Chain Sequences:

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e4bP (P:)
    mernklarqiidtclemtrlglnqgtagqvsvryqdgmlitptgipyeklteshivfidg
    ngkheegklpssewrfhmaayqsrpdanavvhnhavhctavsilnrsipaihymiaaagg
    nsipcapyatfgtrelsehvalalknrkatllqhhgliacevnlekalwlahevevlaql
    ylttlaitdpvpvlsdeeiavvlekf