PDB entry 1e49

View 1e49 on RCSB PDB site
Description: L-Fuculose 1-Phosphate Aldolase from Escherichia coli Mutant N29L/S71A
Class: aldolase (class II)
Keywords: aldolase (class II), bacterial l-fucose metabolism, cleavage of l-fuculose 1-phosphate to dihydroxyacetone phosphate and l-lactaldehyde, mutant structure
Deposited on 2000-06-30, released 2000-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-12, with a file datestamp of 2017-07-07.
Experiment type: XRAY
Resolution: 2.53 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: l-fuculose 1-phosphate aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11550 (0-End)
      • engineered mutation (28)
      • engineered mutation (70)
    Domains in SCOPe 2.07: d1e49p_
  • Heterogens: SO4, BME, ZN, HOH

PDB Chain Sequences:

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1e49P (P:)
    mernklarqiidtclemtrlglnqgtaglvsvryqdgmlitptgipyeklteshivfidg
    ngkheegklpasewrfhmaayqsrpdanavvhnhavhctavsilnrsipaihymiaaagg
    nsipcapyatfgtrelsehvalalknrkatllqhhgliacevnlekalwlahevevlaql
    ylttlaitdpvpvlsdeeiavvlekfktyglriee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e49P (P:)
    mernklarqiidtclemtrlglnqgtaglvsvryqdgmlitptgipyeklteshivfidg
    ngkheegklpasewrfhmaayqsrpdanavvhnhavhctavsilnrsipaihymiaaagg
    nsipcapyatfgtrelsehvalalknrkatllqhhgliacevnlekalwlahevevlaql
    ylttlaitdpvpvlsdeeiavvlekf