PDB entry 1e42

View 1e42 on RCSB PDB site
Description: beta2-adaptin appendage domain, from clathrin adaptor ap2
Deposited on 2000-06-27, released 2000-08-21
The last revision prior to the SCOP 1.71 freeze date was dated 2000-08-21, with a file datestamp of 2000-08-21.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.196
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e42A (A:)
    mgsshhhhhhssglvprgshmgmapggyvapkavwlpavkakgleisgtfthrqghiyme
    mnftnkalqhmtdfaiqfnknsfgvipstplaihtplmpnqsidvslplntlgpvmkmep
    lnnlqvavknnidvfyfscliplnvlfvedgkmerqvflatwkdipnenelqfqikechl
    nadtvssklqnnnvytiakrnvegqdmlyqslkltngiwilaelriqpgnpnytlslkcr
    apevsqyiyqvydsilkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e42A (A:)
    ggyvapkavwlpavkakgleisgtfthrqghiymemnftnkalqhmtdfaiqfnknsfgv
    ipstplaihtplmpnqsidvslplntlgpvmkmeplnnlqvavknnidvfyfscliplnv
    lfvedgkmerqvflatwkdipnenelqfqikechlnadtvssklqnnnvytiakrnvegq
    dmlyqslkltngiwilaelriqpgnpnytlslkcrapevsqyiyqvydsilkn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e42B (B:)
    mgsshhhhhhssglvprgshmgmapggyvapkavwlpavkakgleisgtfthrqghiyme
    mnftnkalqhmtdfaiqfnknsfgvipstplaihtplmpnqsidvslplntlgpvmkmep
    lnnlqvavknnidvfyfscliplnvlfvedgkmerqvflatwkdipnenelqfqikechl
    nadtvssklqnnnvytiakrnvegqdmlyqslkltngiwilaelriqpgnpnytlslkcr
    apevsqyiyqvydsilkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e42B (B:)
    ggyvapkavwlpavkakgleisgtfthrqghiymemnftnkalqhmtdfaiqfnknsfgv
    ipstplaihtplmpnqsidvslplntlgpvmkmeplnnlqvavknnidvfyfscliplnv
    lfvedgkmerqvflatwkdipnenelqfqikechlnadtvssklqnnnvytiakrnvegq
    dmlyqslkltngiwilaelriqpgnpnytlslkcrapevsqyiyqvydsilkn