PDB entry 1e41

View 1e41 on RCSB PDB site
Description: death domain from human fadd/mort1
Class: apoptosis
Keywords: apoptosis, death domain, adapter molecule, fas receptor death inducing signalling complex
Deposited on 2000-06-27, released 2000-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fadd protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1E41 (0-3)
    • Uniprot Q13158 (4-103)
    Domains in SCOPe 2.07: d1e41a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e41A (A:)
    gshmgeedlcaafnvicdnvgkdwrrlarqlkvsdtkidsiedryprnltervreslriw
    kntekenatvahlvgalrscqmnlvadlvqevqqardlqnrsga