PDB entry 1e40

View 1e40 on RCSB PDB site
Description: tris/maltotriose complex of chimaeric amylase from b. amyloliquefaciens and b. licheniformis at 2.2a
Class: hydrolase
Keywords: hydrolase, amylase, family 13, maltotriose, tris, complex
Deposited on 2000-06-27, released 2001-06-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.13
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-amylase
    Species: BACILLUS AMYLOLIQUEFACIENS, synthetic [TaxId:1390]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e40a1, d1e40a2
  • Heterogens: CA, NA, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e40A (A:)
    vngtlmqyfewytpndgqhwkrlqndaehlsdigitavwippaykglsqsdngygpydly
    dlgefqqkgtvrtkygtkselqdaigslhsrnvqvygdvvlnhkagadatedvtavevnp
    anrnqetseeyqikawtdfrfpgrgntysdfkwhwyhfdgadwdesrkisrifkfrgegk
    awdwevssengnydylmyadvdydhpdvvaetkkwgiwyanelsldgfridaakhikfsf
    lrdwvqavrqatgkemftvaeywqnnagklenylnktsfnqsvfdvplhfnlqaassqgg
    gydmrkllngtvvskhplksvtfvdnhdtqpgqslestvqtwfkplayafiltresgypq
    vfygdmygtkgdsqreipalkhkiepilkarkqyaygaqhdyfdhhdivgwtregdssva
    nsglaalitdgpggakrmyvgrqnagetwhditgnrsepvvinsegwgefhvnggsvsiy
    vqr