PDB entry 1e3z

View 1e3z on RCSB PDB site
Description: acarbose complex of chimaeric amylase from b. amyloliquefaciens and b. licheniformis at 1.93a
Class: hydrolase
Keywords: hydrolase, amylase, family 13, acarbose, complex
Deposited on 2000-06-27, released 2001-06-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.13
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-amylase
    Species: BACILLUS AMYLOLIQUEFACIENS, synthetic [TaxId:1390]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e3za1, d1e3za2
  • Heterogens: CA, NA, ACI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e3zA (A:)
    vngtlmqyfewytpndgqhwkrlqndaehlsdigitavwippaykglsqsdngygpydly
    dlgefqqkgtvrtkygtkselqdaigslhsrnvqvygdvvlnhkagadatedvtavevnp
    anrnqetseeyqikawtdfrfpgrgntysdfkwhwyhfdgadwdesrkisrifkfrgegk
    awdwevssengnydylmyadvdydhpdvvaetkkwgiwyanelsldgfridaakhikfsf
    lrdwvqavrqatgkemftvaeywqnnagklenylnktsfnqsvfdvplhfnlqaassqgg
    gydmrkllngtvvskhplksvtfvdnhdtqpgqslestvqtwfkplayafiltresgypq
    vfygdmygtkgdsqreipalkhkiepilkarkqyaygaqhdyfdhhdivgwtregdssva
    nsglaalitdgpggakrmyvgrqnagetwhditgnrsepvvinsegwgefhvnggsvsiy
    vqr