PDB entry 1e3y

View 1e3y on RCSB PDB site
Description: death domain from human fadd/mort1
Deposited on 2000-06-26, released 2000-11-06
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-06, with a file datestamp of 2000-11-06.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1e3ya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1e3yA (A:)
gshmgeedlcaafnvicdnvgkdwrrlarqlkvsdtkidsiedryprnltervreslriw
kntekenatvahlvgalrscqmnlvadlvqevqqardlqnrsga