PDB entry 1e3y

View 1e3y on RCSB PDB site
Description: death domain from human fadd/mort1
Class: apoptosis
Keywords: apoptosis, death domain, adapter molecule, fas receptor death inducing signalling complex
Deposited on 2000-06-26, released 2000-11-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: fadd protein
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 1E3Y (0-3)
  • Uniprot Q13158 (4-103)
  Domains in SCOPe 2.08: d1e3ya1, d1e3ya2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1e3yA (A:)
  gshmgeedlcaafnvicdnvgkdwrrlarqlkvsdtkidsiedryprnltervreslriw
  kntekenatvahlvgalrscqmnlvadlvqevqqardlqnrsga