PDB entry 1e3w

View 1e3w on RCSB PDB site
Description: Rat brain 3-hydroxyacyl-CoA dehydrogenase binary complex with NADH and 3-keto butyrate
Class: dehydrogenase
Keywords: dehydrogenase, beta-oxidation of fatty acids, steroids, amyloid binding
Deposited on 2000-06-26, released 2001-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-12, with a file datestamp of 2017-07-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: short chain 3-hydroxyacyl-coa dehydrogenase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 1E3W
    • Uniprot O70351 (Start-260)
    Domains in SCOPe 2.07: d1e3wa_
  • Chain 'B':
    Compound: short chain 3-hydroxyacyl-coa dehydrogenase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 1E3W
    • Uniprot O70351 (Start-260)
    Domains in SCOPe 2.07: d1e3wb_
  • Chain 'C':
    Compound: short chain 3-hydroxyacyl-coa dehydrogenase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 1E3W
    • Uniprot O70351 (Start-260)
    Domains in SCOPe 2.07: d1e3wc_
  • Chain 'D':
    Compound: short chain 3-hydroxyacyl-coa dehydrogenase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 1E3W
    • Uniprot O70351 (Start-260)
    Domains in SCOPe 2.07: d1e3wd_
  • Heterogens: NAD, TRS, SO4, AAE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e3wA (A:)
    maaavrsvkglvavitggasglglstakrlvgqgatavlldvpnsegeteakklggncif
    apanvtsekevqaaltlakekfgridvavncagiavaiktyhekknqvhtledfqrvinv
    nligtfnvirlvagvmgqnepdqggqrgviintasvaafegqvgqaaysaskggivgmtl
    piardlapigirvvtiapglfatpllttlpdtvrnflasqvpfpsrlgdpaeyahlvqmv
    ienpflngevirldgairmqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e3wA (A:)
    svkglvavitggasglglstakrlvgqgatavlldvpnsegeteakklggncifapanvt
    sekevqaaltlakekfgridvavncagiavaiktyhekknqvhtledfqrvinvnligtf
    nvirlvagvmgqnepdqggqrgviintasvaafegqvgqaaysaskggivgmtlpiardl
    apigirvvtiapglfatpllttvrnflasqvpfpsrlgdpaeyahlvqmvienpflngev
    irldgairmqp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e3wB (B:)
    maaavrsvkglvavitggasglglstakrlvgqgatavlldvpnsegeteakklggncif
    apanvtsekevqaaltlakekfgridvavncagiavaiktyhekknqvhtledfqrvinv
    nligtfnvirlvagvmgqnepdqggqrgviintasvaafegqvgqaaysaskggivgmtl
    piardlapigirvvtiapglfatpllttlpdkvrnflasqvpfpsrlgdpaeyahlvqmv
    ienpflngevirldgairmqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e3wB (B:)
    svkglvavitggasglglstakrlvgqgatavlldvpnsegeteakklggncifapanvt
    sekevqaaltlakekfgridvavncagiavaiktyhekknqvhtledfqrvinvnligtf
    nvirlvagvmgqnepdqggqrgviintasvaafegqvgqaaysaskggivgmtlpiardl
    apigirvvtiapglfatplltflasqvpfpsrlgdpaeyahlvqmvienpflngevirld
    gairmqp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1e3wC (C:)
    maaavrsvkglvavitggasglglstakrlvgqgatavlldvpnsegeteakklggncif
    apanvtsekevqaaltlakekfgridvavncagiavaiktyhekknqvhtledfqrvinv
    nligtfnvirlvagvmgqnepdqggqrgviintasvaafegqvgqaaysaskggivgmtl
    piardlapigirvvtiapglfatpllttlpdkvrnflasqvpfpsrlgdpaeyahlvqmv
    ienpflngevirldgairmqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e3wC (C:)
    svkglvavitggasglglstakrlvgqgatavlldvpnsegeteakklggncifapanvt
    sekevqaaltlakekfgridvavncagiavaiktyhekknqvhtledfqrvinvnligtf
    nvirlvagvmgqnepdqggqrgviintasvaafegqvgqaaysaskggivgmtlpiardl
    apigirvvtiapglfatplltnflasqvpfpsrlgdpaeyahlvqmvienpflngevirl
    dgairmqp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1e3wD (D:)
    maaavrsvkglvavitggasglglstakrlvgqgatavlldvpnsegeteakklggncif
    apanvtsekevqaaltlakekfgridvavncagiavaiktyhekknqvhtledfqrvinv
    nligtfnvirlvagvmgqnepdqggqrgviintasvaafegqvgqaaysaskggivgmtl
    piardlapigirvvtiapglfatpllttlpdkvrnflasqvpfpsrlgdpaeyahlvqmv
    ienpflngevirldgairmqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e3wD (D:)
    svkglvavitggasglglstakrlvgqgatavlldvpnsegeteakklggncifapanvt
    sekevqaaltlakekfgridvavncagiavaiktyhekknqvhtledfqrvinvnligtf
    nvirlvagvmgqnepdqggqrgviintasvaafegqvgqaaysaskggivgmtlpiardl
    apigirvvtiapglfatpllttlpdkvrnflasqvpfpsrlgdpaeyahlvqmvienpfl
    ngevirldgairmqp