PDB entry 1e3v

View 1e3v on RCSB PDB site
Description: crystal structure of ketosteroid isomerase from psedomonas putida complexed with deoxycholate
Class: isomerase
Keywords: isomerase, deoxychlate, ksi, lbhb, reverse binding
Deposited on 2000-06-24, released 2001-03-12
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: steroid delta-isomerase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1e3va_
  • Chain 'B':
    Compound: steroid delta-isomerase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1e3vb_
  • Heterogens: DXC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e3vA (A:)
    mnlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqg
    lgggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayw
    sevnlsvrepq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e3vA (A:)
    nlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqgl
    gggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayws
    evnlsvre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e3vB (B:)
    mnlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqg
    lgggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayw
    sevnlsvrepq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e3vB (B:)
    nlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqgl
    gggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayws
    evnlsvrep