PDB entry 1e3u

View 1e3u on RCSB PDB site
Description: MAD structure of OXA10 class D beta-lactamase
Class: beta-lactamase
Keywords: beta-lactamase, antiobitic resistance
Deposited on 2000-06-23, released 2001-01-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-12, with a file datestamp of 2017-07-07.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-lactamase oxa-10
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e3ua_
  • Chain 'B':
    Compound: beta-lactamase oxa-10
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e3ub_
  • Chain 'C':
    Compound: beta-lactamase oxa-10
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e3uc_
  • Chain 'D':
    Compound: beta-lactamase oxa-10
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14489 (Start-245)
      • conflict (72)
    Domains in SCOPe 2.07: d1e3ud_
  • Heterogens: AUC, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e3uA (A:)
    sitentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiiglet
    gviknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkfs
    ygnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaapey
    lvhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkimes
    egiigg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e3uA (A:)
    itentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiigletg
    viknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkfsy
    gnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaapeyl
    vhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkimese
    gii
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e3uB (B:)
    sitentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiiglet
    gviknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkfs
    ygnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaapey
    lvhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkimes
    egiigg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e3uB (B:)
    itentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiigletg
    viknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkfsy
    gnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaapeyl
    vhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkimese
    gii
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1e3uC (C:)
    sitentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiiglet
    gviknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkfs
    ygnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaapey
    lvhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkimes
    egiigg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e3uC (C:)
    itentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiigletg
    viknehqvfkwdramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkfsygnq
    nisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaapeylvhs
    ktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkimesegii
    gg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1e3uD (D:)
    sitentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiiglet
    gviknehqvfkwpgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkfs
    ygnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaapey
    lvhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkimes
    egiigg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e3uD (D:)
    itentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiigletg
    viknehqvfkwpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkfsygnq
    nisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaapeylvhs
    ktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkimesegii
    gg