PDB entry 1e3t

View 1e3t on RCSB PDB site
Description: solution structure of the nadp(h) binding component (diii) of proton-translocating transhydrogenase from rhodospirillum rubrum
Deposited on 2000-06-22, released 2000-10-03
The last revision prior to the SCOP 1.69 freeze date was dated 2000-10-03, with a file datestamp of 2000-10-03.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1e3ta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e3tA (A:)
    mnrsifnvilggfgseggvaaaggaagdrsvkagsaedaafimknaskviivpgygmava
    qaqhalremadvlkkegvevsyaihpvagrmpghmnvllaeanvpydevfeleeinssfq
    tadvafvigandvtnpaaktdpsspiygmpildvekagtvlfikrsmasgyagvenelff
    rnntmmlfgdakkmteqivqamn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e3tA (A:)
    rsvkagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsyaihpva
    grmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdpsspiyg
    mpildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn