PDB entry 1e3t

View 1e3t on RCSB PDB site
Description: solution structure of the nadp(h) binding component (diii) of proton-translocating transhydrogenase from rhodospirillum rubrum
Class: transhydrogenase
Keywords: transhydrogenase, membrane protein, proton translocation, nmr structure, nucleotide binding
Deposited on 2000-06-22, released 2000-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nicotinamide nucleotide transhydrogenase (subunit beta)
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: PNTB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e3ta_
  • Heterogens: NAP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e3tA (A:)
    mnrsifnvilggfgseggvaaaggaagdrsvkagsaedaafimknaskviivpgygmava
    qaqhalremadvlkkegvevsyaihpvagrmpghmnvllaeanvpydevfeleeinssfq
    tadvafvigandvtnpaaktdpsspiygmpildvekagtvlfikrsmasgyagvenelff
    rnntmmlfgdakkmteqivqamn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e3tA (A:)
    rsvkagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsyaihpva
    grmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdpsspiyg
    mpildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn