PDB entry 1e3s

View 1e3s on RCSB PDB site
Description: rat brain 3-hydroxyacyl-coa dehydrogenase binary complex with nadh
Class: oxidoreductase
Keywords: oxidoreductase, dehydrogenase, beta-oxidation of fatty acids, steroids, amyloid binding
Deposited on 2000-06-22, released 2001-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: short chain 3-hydroxyacyl-coa dehydrogenase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 1E3S
    • Uniprot O70351 (Start-260)
    Domains in SCOPe 2.07: d1e3sa_
  • Chain 'B':
    Compound: short chain 3-hydroxyacyl-coa dehydrogenase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 1E3S
    • Uniprot O70351 (Start-260)
    Domains in SCOPe 2.07: d1e3sb_
  • Chain 'C':
    Compound: short chain 3-hydroxyacyl-coa dehydrogenase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 1E3S
    • Uniprot O70351 (Start-260)
    Domains in SCOPe 2.07: d1e3sc_
  • Chain 'D':
    Compound: short chain 3-hydroxyacyl-coa dehydrogenase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 1E3S
    • Uniprot O70351 (Start-260)
    Domains in SCOPe 2.07: d1e3sd_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e3sA (A:)
    maaavrsvkglvavitggasglglstakrlvgqgatavlldvpnsegeteakklggncif
    apanvtsekevqaaltlakekfgridvavncagiavaiktyhekknqvhtledfqrvinv
    nligtfnvirlvagvmgqnepdqggqrgviintasvaafegqvgqaaysaskggivgmtl
    piardlapigirvvtiapglfatpllttlpdkvrnflasqvpfpsrlgdpaeyahlvqmv
    ienpflngevirldgairmqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e3sA (A:)
    svkglvavitggasglglstakrlvgqgatavlldvpnsegeteakklggncifapanvt
    sekevqaaltlakekfgridvavncagiavaiktyhekknqvhtledfqrvinvnligtf
    nvirlvagvmgqnepdqggqrgviintasvaafegqvgqaaysaskggivgmtlpiardl
    apigirvvtiapglfatpsqvpfpsrlgdpaeyahlvqmvienpflngevirldgairmq
    p
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e3sB (B:)
    maaavrsvkglvavitggasglglstakrlvgqgatavlldvpnsegeteakklggncif
    apanvtsekevqaaltlakekfgridvavncagiavaiktyhekknqvhtledfqrvinv
    nligtfnvirlvagvmgqnepdqggqrgviintasvaafegqvgqaaysaskggivgmtl
    piardlapigirvvtiapglfatpllttlpdkvrnflasqvpfpsrlgdpaeyahlvqmv
    ienpflngevirldgairmqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e3sB (B:)
    svkglvavitggasglglstakrlvgqgatavlldvpnsegeteakklggncifapanvt
    sekevqaaltlakekfgridvavncagiavaiktyhekknqvhtledfqrvinvnligtf
    nvirlvagvmgqnepdqggqrgviintasvaafegqvgqaaysaskggivgmtlpiardl
    apigirvvtiapglfatpsqvpfpsrlgdpaeyahlvqmvienpflngevirldgairmq
    p
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1e3sC (C:)
    maaavrsvkglvavitggasglglstakrlvgqgatavlldvpnsegeteakklggncif
    apanvtsekevqaaltlakekfgridvavncagiavaiktyhekknqvhtledfqrvinv
    nligtfnvirlvagvmgqnepdqggqrgviintasvaafegqvgqaaysaskggivgmtl
    piardlapigirvvtiapglfatpllttlpdkvrnflasqvpfpsrlgdpaeyahlvqmv
    ienpflngevirldgairmqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e3sC (C:)
    svkglvavitggasglglstakrlvgqgatavlldvpnsegeteakklggncifapanvt
    sekevqaaltlakekfgridvavncagiavaiktyhekknqvhtledfqrvinvnligtf
    nvirlvagvmgqnepdqggqrgviintasvaafegqvgqaaysaskggivgmtlpiardl
    apigirvvtiapglfatpsqvpfpsrlgdpaeyahlvqmvienpflngevirldgairmq
    p
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1e3sD (D:)
    maaavrsvkglvavitggasglglstakrlvgqgatavlldvpnsegeteakklggncif
    apanvtsekevqaaltlakekfgridvavncagiavaiktyhekknqvhtledfqrvinv
    nligtfnvirlvagvmgqnepdqggqrgviintasvaafegqvgqaaysaskggivgmtl
    piardlapigirvvtiapglfatpllttlpdkvrnflasqvpfpsrlgdpaeyahlvqmv
    ienpflngevirldgairmqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e3sD (D:)
    svkglvavitggasglglstakrlvgqgatavlldvpnsegeteakklggncifapanvt
    sekevqaaltlakekfgridvavncagiavaiktyhekknqvhtledfqrvinvnligtf
    nvirlvagvmgqnepdqggqrgviintasvaafegqvgqaaysaskggivgmtlpiardl
    apigirvvtiapglfatpsqvpfpsrlgdpaeyahlvqmvienpflngevirldgairmq
    p