PDB entry 1e3o

View 1e3o on RCSB PDB site
Description: Crystal structure of Oct-1 POU dimer bound to MORE
Class: transcription
Keywords: transcription, pou domain, dimer, DNA binding
Deposited on 2000-06-20, released 2001-06-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.22
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-d(*ap*tp*gp*cp*ap*tp*gp*ap*gp*gp*a)-3'
  • Chain 'B':
    Compound: 5'-d(*tp*cp*cp*tp*cp*ap*tp*gp*cp*ap*t)-3'
  • Chain 'C':
    Compound: octamer-binding transcription factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14859 (0-159)
      • engineered mutation (60)
      • conflict (120)
      • conflict (129)
      • conflict (132)
      • conflict (135)
      • engineered mutation (149)
    Domains in SCOPe 2.06: d1e3oc1, d1e3oc2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >1e3oC (C:)
eepsdleeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknm
sklkpllekwlndaeanlssdsslsspsalnspgieglsrrrkkrtsietnirvaleksf
menqkptseditliaeqlnmekevirvwfsnrrqkekrin

    Sequence, based on observed residues (ATOM records): (download) 
    >1e3oC (C:)
eepsdleeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknm
sklkpllekwlndaekrtsietnirvaleksfmenqkptseditliaeqlnmekevirvw
fsnrrqkekrin