PDB entry 1e3o

View 1e3o on RCSB PDB site
Description: crystal structure of oct-1 pou dimer bound to more
Deposited on 2000-06-20, released 2001-06-14
The last revision prior to the SCOP 1.71 freeze date was dated 2001-11-10, with a file datestamp of 2001-11-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.22
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1e3oC (C:)
    eepsdleeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknm
    sklkpllekwlndaeanlssdsslsspsalnspgieglsrrrkkrtsietnirvaleksf
    menqkptseditliaeqlnmekevirvwfsnrrqkekrin
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e3oC (C:)
    eepsdleeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknm
    sklkpllekwlndaekrtsietnirvaleksfmenqkptseditliaeqlnmekevirvw
    fsnrrqkekrin