PDB entry 1e3n

View 1e3n on RCSB PDB site
Description: high resolution crystal structure of pi ketosteroid isomerase mutant d40n(d38n, ti numbering) complexed with equilenin at 2.0 a resolution.
Class: isomerase
Keywords: ketosteroid isomerase, ksi, equilenin, pi, lbhb
Deposited on 2000-06-20, released 2001-06-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2003-05-27, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isomerase
    Species: Pseudomonas putida
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07445
      • engineered mutation (39)
    Domains in SCOPe 2.06: d1e3na_
  • Chain 'B':
    Compound: isomerase
    Species: Pseudomonas putida
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07445
      • engineered mutation (39)
    Domains in SCOPe 2.06: d1e3nb_
  • Heterogens: EQU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e3nA (A:)
    mnlptaqevqglmaryielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqg
    lgggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayw
    sevnlsvrepq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e3nA (A:)
    nlptaqevqglmaryielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqgl
    gkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqaywsev
    nlsv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e3nB (B:)
    mnlptaqevqglmaryielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqg
    lgggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayw
    sevnlsvrepq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e3nB (B:)
    nlptaqevqglmaryielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqgl
    gkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqaywsev
    nlsv