PDB entry 1e3m

View 1e3m on RCSB PDB site
Description: the crystal structure of e. coli muts binding to dna with a g:t mismatch
Deposited on 2000-06-19, released 2000-11-01
The last revision prior to the SCOP 1.69 freeze date was dated 2000-11-01, with a file datestamp of 2000-11-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.22891
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e3mA (A:)
    msaienfdahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrga
    sagepipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtpgtis
    deallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpaelly
    aedfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglcaagcl
    lqyakdtqrttlphirsitmereqdsiimdaatrrnleitqnlaggaentlasvldctvt
    pmgsrmlkrwlhmpvrdtrvllerqqtigalqdftaglqpvlrqvgdlerilarlalrta
    rprdlarmrhafqqlpelraqletvdsapvqalrekmgefaelrdlleraiidtppvlvr
    dggviasgyneeldewraladgatdylerlevrerertgldtlkvgfnavhgyyiqisrg
    qshlapinymrrqtlknaeryiipelkeyedkvltskgkalalekqlyeelfdlllphle
    alqqsasalaeldvlvnlaeraytlnytcptfidkpgiritegrhpvveqvlnepfianp
    lnlspqrrmliitgpnmggkstymrqtalialmayigsyvpaqkveigpidriftrvgaa
    ddlasgrstfmvemtetanilhnateyslvlmdeigrgtstydglslawacaenlankik
    altlfathyfeltqlpekmegvanvhldalehgdtiafmhsvqdgaasksyglavaalag
    vpkevikrarqklrelesis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e3mA (A:)
    saienfdahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrgas
    agepipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtpgtisd
    eallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpaellya
    edfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglcaagcll
    qyakdtqrttlphirsitmereqdsiimdaatrrnleitqnlaggaentlasvldctvtp
    mgsrmlkrwlhmpvrdtrvllerqqtigalqdftaglqpvlrqvgdlerilarlalrtar
    prdlarmrhafqqlpelraqletvdsapvqalrekmgefaelrdlleraiidtppvlvrd
    ggviasgyneeldewraladgatdylerlevrerertgldtlkvgfnavhgyyiqisrgq
    shlapinymrrqtlknaeryiipelkeyedkvltskgkalalekqlyeelfdlllphlea
    lqqsasalaeldvlvnlaeraytlnytcptfidkpgiritegrhpvveqvlnepfianpl
    nlspqrrmliitgpnmggkstymrqtalialmayigsyvpaqkveigpidriftrvgfmv
    emtetanilhnateyslvlmdeigrgtstydglslawacaenlankikaltlfathyfel
    tqlpekmegvanvhldalehgdtiafmhsvqdgaasksyglavaalagvpkevikrarqk
    lrelesis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e3mB (B:)
    msaienfdahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrga
    sagepipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtpgtis
    deallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpaelly
    aedfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglcaagcl
    lqyakdtqrttlphirsitmereqdsiimdaatrrnleitqnlaggaentlasvldctvt
    pmgsrmlkrwlhmpvrdtrvllerqqtigalqdftaglqpvlrqvgdlerilarlalrta
    rprdlarmrhafqqlpelraqletvdsapvqalrekmgefaelrdlleraiidtppvlvr
    dggviasgyneeldewraladgatdylerlevrerertgldtlkvgfnavhgyyiqisrg
    qshlapinymrrqtlknaeryiipelkeyedkvltskgkalalekqlyeelfdlllphle
    alqqsasalaeldvlvnlaeraytlnytcptfidkpgiritegrhpvveqvlnepfianp
    lnlspqrrmliitgpnmggkstymrqtalialmayigsyvpaqkveigpidriftrvgaa
    ddlasgrstfmvemtetanilhnateyslvlmdeigrgtstydglslawacaenlankik
    altlfathyfeltqlpekmegvanvhldalehgdtiafmhsvqdgaasksyglavaalag
    vpkevikrarqklrelesis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e3mB (B:)
    mqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltpmagipyhavenylakl
    vnqgesvaicerkvvrivtpgtisdeallqerqdnllaaiwqdskgfgyatldissgrfr
    lsepadretmaaelqrtnpaellyaedfaemsliegrrglrrrplwefeidtarqqlnlq
    fgtrdlvgfgvenaprglcaagcllqyakdtqrttlphirsitmereqdsiimdaatrrn
    leitqnlaggaentlasvldctvtpmgsrmlkrwlhmpvrdtrvllerqqtigalqdfta
    glqpvlrqvgdlerilarlalrtarprdlarmrhafqqlpelraqletvdsapvqalrek
    mgefaelrdlleraiidtppvlvrdggviasgyneeldewraladgatdylerlevrere
    rtgldtlkvgfnavhgyyiqisrgqshlapinymrrqtlknaeryiipelkeyedkvlts
    kgkalalekqlyeelfdlllphlealqqsasalaeldvlvnlaeraytlnytcptfidkp
    giritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrqtalialmayi
    gsyvpaqkveigpidriftrvgtfmvemtetanilhnateyslvlmdeigrgtstydgls
    lawacaenlankikaltlfathyfeltqlpekmegvanvhldalehgdtiafmhsvqdga
    asksyglavaalagvpkevikrarqklrelesis