PDB entry 1e3l

View 1e3l on RCSB PDB site
Description: p47h mutant of mouse class II alcohol dehydrogenase complex with nadh
Class: alcohol dehydrogenase
Keywords: alcohol dehydrogenase
Deposited on 2000-06-19, released 2000-09-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.1973
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alcohol dehydrogenase, class II
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QYY9 (0-375)
      • engineered mutation (46)
    Domains in SCOPe 2.06: d1e3la1, d1e3la2
  • Chain 'B':
    Compound: alcohol dehydrogenase, class II
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QYY9 (Start-375)
      • engineered mutation (46)
    Domains in SCOPe 2.06: d1e3lb1, d1e3lb2
  • Heterogens: NAD, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e3lA (A:)
    gtqgkvikckaaiawktgsplcieeievsppkacevriqviatcvchtdinatdpkkkal
    fpvvlghecagivesvgpgvtnfkpgdkvipffapqckrcklclspltnlcgklrnfkyp
    tidqelmedrtsrftckgrsiyhfmgvssfsqytvvseanlarvddeanlervcligcgf
    ssgygaaintakvtpgstcavfglgcvglsaiigckiagasriiaidingekfpkakalg
    atdclnpreldkpvqdviteltaggvdysldcagtaqtlkaavdctvlgwgsctvvgakv
    demtiptvdvilgrsingtffggwksvdsvpnlvsdyknkkfdldllvthalpfesinda
    idlmkegksirtiltf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e3lB (B:)
    gtqgkvikckaaiawktgsplcieeievsppkacevriqviatcvchtdinatdpkkkal
    fpvvlghecagivesvgpgvtnfkpgdkvipffapqckrcklclspltnlcgklrnfkyp
    tidqelmedrtsrftckgrsiyhfmgvssfsqytvvseanlarvddeanlervcligcgf
    ssgygaaintakvtpgstcavfglgcvglsaiigckiagasriiaidingekfpkakalg
    atdclnpreldkpvqdviteltaggvdysldcagtaqtlkaavdctvlgwgsctvvgakv
    demtiptvdvilgrsingtffggwksvdsvpnlvsdyknkkfdldllvthalpfesinda
    idlmkegksirtiltf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e3lB (B:)
    gkvikckaaiawktgsplcieeievsppkacevriqviatcvchtdinatdpkkkalfpv
    vlghecagivesvgpgvtnfkpgdkvipffapqckrcklclspltnlcgklrnfkyptid
    qelmedrtsrftckgrsiyhfmgvssfsqytvvseanlarvddeanlervcligcgfssg
    ygaaintakvtpgstcavfglgcvglsaiigckiagasriiaidingekfpkakalgatd
    clnpreldkpvqdviteltaggvdysldcagtaqtlkaavdctvlgwgsctvvgakvdem
    tiptvdvilgrsingtffggwksvdsvpnlvsdyknkkfdldllvthalpfesindaidl
    mkegksirtiltf