PDB entry 1e3l

View 1e3l on RCSB PDB site
Description: p47h mutant of mouse class ii alcohol dehydrogenase complex with nadh
Deposited on 2000-06-19, released 2000-09-12
The last revision prior to the SCOP 1.55 freeze date was dated 2000-09-12, with a file datestamp of 2000-09-12.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.1973
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e3lA (A:)
    gtqgkvikckaaiawktgsplcieeievsppkacevriqviatcvchtdinatdpkkkal
    fpvvlghecagivesvgpgvtnfkpgdkvipffapqckrcklclspltnlcgklrnfkyp
    tidqelmedrtsrftckgrsiyhfmgvssfsqytvvseanlarvddeanlervcligcgf
    ssgygaaintakvtpgstcavfglgcvglsaiigckiagasriiaidingekfpkakalg
    atdclnpreldkpvqdviteltaggvdysldcagtaqtlkaavdctvlgwgsctvvgakv
    demtiptvdvilgrsingtffggwksvdsvpnlvsdyknkkfdldllvthalpfesinda
    idlmkegksirtiltf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e3lB (B:)
    gkvikckaaiawktgsplcieeievsppkacevriqviatcvchtdinatdpkkkalfpv
    vlghecagivesvgpgvtnfkpgdkvipffapqckrcklclspltnlcgklrnfkyptid
    qelmedrtsrftckgrsiyhfmgvssfsqytvvseanlarvddeanlervcligcgfssg
    ygaaintakvtpgstcavfglgcvglsaiigckiagasriiaidingekfpkakalgatd
    clnpreldkpvqdviteltaggvdysldcagtaqtlkaavdctvlgwgsctvvgakvdem
    tiptvdvilgrsingtffggwksvdsvpnlvsdyknkkfdldllvthalpfesindaidl
    mkegksirtiltf