PDB entry 1e3k

View 1e3k on RCSB PDB site
Description: human progesteron receptor ligand binding domain in complex with the ligand metribolone (r1881)
Deposited on 2000-06-19, released 2001-06-14
The last revision prior to the SCOP 1.57 freeze date was dated 2001-06-14, with a file datestamp of 2001-06-14.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.24
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1e3ka_
  • Chain 'B':
    Domains in SCOP 1.57: d1e3kb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e3kA (A:)
    qlipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrn
    lhiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltm
    wqipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqk
    gvvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkil
    agmvkpllfhk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e3kB (B:)
    lipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrnl
    hiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmw
    qipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqkg
    vvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkila
    gmvkpllfh