PDB entry 1e3j

View 1e3j on RCSB PDB site
Description: ketose reductase (sorbitol dehydrogenase) from silverleaf whitefly
Deposited on 2000-06-19, released 2001-02-04
The last revision prior to the SCOP 1.55 freeze date was dated 2001-02-04, with a file datestamp of 2001-02-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.219
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e3jA (A:)
    dnlsavlykqndlrleqrpipepkedevllqmayvgicgsdvhyyehgriadfivkdpmv
    igheasgtvvkvgknvkhlkkgdrvavepgvpcrrcqfckegkynlcpdltfcatppddg
    nlaryyvhaadfchklpdnvsleegalleplsvgvhacrragvqlgttvlvigagpiglv
    svlaakaygafvvctarsprrlevakncgadvtlvvdpakeeessiierirsaigdlpnv
    tidcsgnekcitiginitrtggtlmlvgmgsqmvtvplvnacareidiksvfrycndypi
    alemvasgrcnvkqlvthsfkleqtvdafeaarkkadntikvmiscrq