PDB entry 1e3i

View 1e3i on RCSB PDB site
Description: Mouse class II alcohol dehydrogenase complex with NADH and inhibitor
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2000-06-16, released 2000-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.198
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alcohol dehydrogenase, class II
    Species: Mus musculus [TaxId:10090]
    Gene: ADH-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e3ia1, d1e3ia2
  • Chain 'B':
    Compound: alcohol dehydrogenase, class II
    Species: Mus musculus [TaxId:10090]
    Gene: ADH-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e3ib1, d1e3ib2
  • Heterogens: NAI, CXF, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e3iA (A:)
    gtqgkvikckaaiawktgsplcieeievsppkacevriqviatcvcptdinatdpkkkal
    fpvvlghecagivesvgpgvtnfkpgdkvipffapqckrcklclspltnlcgklrnfkyp
    tidqelmedrtsrftckgrsiyhfmgvssfsqytvvseanlarvddeanlervcligcgf
    ssgygaaintakvtpgstcavfglgcvglsaiigckiagasriiaidingekfpkakalg
    atdclnpreldkpvqdviteltaggvdysldcagtaqtlkaavdctvlgwgsctvvgakv
    demtiptvdvilgrsingtffggwksvdsvpnlvsdyknkkfdldllvthalpfesinda
    idlmkegksirtiltf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e3iB (B:)
    gtqgkvikckaaiawktgsplcieeievsppkacevriqviatcvcptdinatdpkkkal
    fpvvlghecagivesvgpgvtnfkpgdkvipffapqckrcklclspltnlcgklrnfkyp
    tidqelmedrtsrftckgrsiyhfmgvssfsqytvvseanlarvddeanlervcligcgf
    ssgygaaintakvtpgstcavfglgcvglsaiigckiagasriiaidingekfpkakalg
    atdclnpreldkpvqdviteltaggvdysldcagtaqtlkaavdctvlgwgsctvvgakv
    demtiptvdvilgrsingtffggwksvdsvpnlvsdyknkkfdldllvthalpfesinda
    idlmkegksirtiltf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e3iB (B:)
    gkvikckaaiawktgsplcieeievsppkacevriqviatcvcptdinatdpkkkalfpv
    vlghecagivesvgpgvtnfkpgdkvipffapqckrcklclspltnlcgklrnfkyptid
    qelmedrtsrftckgrsiyhfmgvssfsqytvvseanlarvddeanlervcligcgfssg
    ygaaintakvtpgstcavfglgcvglsaiigckiagasriiaidingekfpkakalgatd
    clnpreldkpvqdviteltaggvdysldcagtaqtlkaavdctvlgwgsctvvgakvdem
    tiptvdvilgrsingtffggwksvdsvpnlvsdyknkkfdldllvthalpfesindaidl
    mkegksirtiltf