PDB entry 1e3c

View 1e3c on RCSB PDB site
Description: crystal structure of an arylsulfatase a mutant c69s soaked in synthetic substrate
Class: hydrolase
Keywords: hydrolase, cerebroside-3-sulfate hydrolysis, lysosomal enzyme, formylglycine
Deposited on 2000-06-13, released 2001-03-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.174
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: arylsulfatase a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15289 (0-End)
      • conflict (196)
      • engineered mutation (50)
    Domains in SCOPe 2.06: d1e3cp_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1e3cP (P:)
    rppnivlifaddlgygdlgcyghpssttpnldqlaagglrftdfyvpvslstpsraallt
    grlpvrmgmypgvlvpssrgglpleevtvaevlaargyltgmagkwhlgvgpegaflpph
    qgfhrflgipyshdqgpcqnltcfppatpcdggcdqglvpipllanlsveaqppwlpgle
    arymafahdlmadaqredrpfflyyashhthypqfsgqsfaersgrgpfgdslmeldaav
    gtlmtaigdlglleetlviftadngpetmrmsrggcsgllrcgkgttyeggvrepalafw
    pghiapgvthelassldllptlaalagaplpnvtldgfdlsplllgtgksprqslffyps
    ypdevrgvfavrtgkykahfftqgsahsdttadpachasssltaheppllydlskdpgen
    ynllggvagatpevlqalkqlqllkaqldaavtfgpsqvargedpalqicchpgctprpa
    cchcpdpha
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e3cP (P:)
    rppnivlifaddlgygdlgcyghpssttpnldqlaagglrftdfyvpvslstpsraallt
    grlpvrmgmypgvlvpssrgglpleevtvaevlaargyltgmagkwhlgvgpegaflpph
    qgfhrflgipyshdqgpcqnltcfppatpcdggcdqglvpipllanlsveaqppwlpgle
    arymafahdlmadaqredrpfflyyashhthypqfsgqsfaersgrgpfgdslmeldaav
    gtlmtaigdlglleetlviftadngpetmrmsrggcsgllrcgkgttyeggvrepalafw
    pghiapgvthelassldllptlaalagaplpnvtldgfdlsplllgtgksprqslffyps
    ypdevrgvfavrtgkykahfftqgsahsdttadpachasssltaheppllydlskdpgen
    ynllgatpevlqalkqlqllkaqldaavtfgpsqvargedpalqicchpgctprpacchc
    p