PDB entry 1e3b

View 1e3b on RCSB PDB site
Description: cyclophilin 3 from c.elegans complexed with aup(et)3
Deposited on 2000-06-08, released 2000-10-22
The last revision prior to the SCOP 1.57 freeze date was dated 2000-10-22, with a file datestamp of 2000-10-22.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.1848
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1e3ba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1e3bA (A:)
msrskvffditiggkasgrivmelyddvvpktagnfralctgengigksgkplhfkgskf
hriipnfmiqggdftrgngtggesiygekfpdenfkekhtgpgvlsmanagpntngsqff
lctvktewldgkhvvfgrvvegldvvkavesngsqsgkpvkdcmiadcgqlk