PDB entry 1e3b

View 1e3b on RCSB PDB site
Description: cyclophilin 3 from c.elegans complexed with aup(et)3
Class: isomerase
Keywords: isomerase, aupet3 adduct cyclophilin antiarthritic gold
Deposited on 2000-06-08, released 2000-10-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.1848
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclophilin 3
    Species: Caenorhabditis elegans [TaxId:6239]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e3ba_
  • Heterogens: AU, 3EP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e3bA (A:)
    msrskvffditiggkasgrivmelyddvvpktagnfralctgengigksgkplhfkgskf
    hriipnfmiqggdftrgngtggesiygekfpdenfkekhtgpgvlsmanagpntngsqff
    lctvktewldgkhvvfgrvvegldvvkavesngsqsgkpvkdcmiadcgqlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e3bA (A:)
    msrskvffditiggkasgrivmelyddvvpktagnfralctgengigksgkplhfkgskf
    hriipnfmiqggdftrgngtggesiygekfpdenfkekhtgpgvlsmanagpntngsqff
    lctvktewldgkhvvfgrvvegldvvkavesngsqsgkpvkdcmiadcgqlk