PDB entry 1e3a

View 1e3a on RCSB PDB site
Description: A slow processing precursor penicillin acylase from Escherichia coli
Class: antibiotic resistance
Keywords: antibiotic resistance, amidase, ntn-hydrolase, hydrolysis of penicillin g acylase
Deposited on 2000-06-07, released 2000-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-22, with a file datestamp of 2014-10-17.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.149
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: penicillin amidase alpha subunit
    Species: Escherichia coli [TaxId:562]
    Gene: PAC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e3a.1
  • Chain 'B':
    Compound: penicillin amidase beta subunit
    Species: Escherichia coli [TaxId:562]
    Gene: PAC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06875 (0-559)
      • engineered mutation (2)
    Domains in SCOPe 2.07: d1e3a.1
  • Heterogens: CA, CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e3aA (A:)
    eqssseikivrdeygmphiyandtwhlfygygyvvaqdrlfqmemarrstqgtvaevlgk
    dfvkfdkdirrnywpdairaqiaalspedmsilqgyadgmnawidkvntnpetllpkqfn
    tfgftpkrwepfdvamifvgtmanrfsdstseidnlalltalkdkygvsqgmavfnqlkw
    lvnpsapttiavqesnyplkfnqqnsqtaallprydlpapmldrpakgadgallalaagk
    nretiaaqfaqgganglagy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e3aA (A:)
    ssseikivrdeygmphiyandtwhlfygygyvvaqdrlfqmemarrstqgtvaevlgkdf
    vkfdkdirrnywpdairaqiaalspedmsilqgyadgmnawidkvntnpetllpkqfntf
    gftpkrwepfdvamifvgtmanrfsdstseidnlalltalkdkygvsqgmavfnqlkwlv
    npsapttiavqesnyplkfnqqnsqtaallprydlpapmldrpakgadgallalaagknr
    etiaaqfaqgganglagy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e3aB (B:)
    ptgsnmwvigkskaqdakaimvngpqfgwyapaytygiglhgagydvtgntpfaypglvf
    ghngviswgstagfgddvdifaerlsaekpgyylhngkwvkmlsreetitvkngqaetft
    vwrtvhgnilqtdqttqtayaksrawdgkevasllawthqmkaknwqewtqqaakqalti
    nwyyadvngnigyvhtgaypdrqsghdprlpvpgtgkwdwkgllpfemnpkvynpqsgyi
    anwnnspqkdypasdlfaflwggadrvteidrlleqkprltadqawdvirqtsrqdlnlr
    lflptlqaatsgltqsdprrqlvetltrwdginllnddgktwqqpgsailnvwltsmlkr
    tvvaavpmpfdkwysasgyettqdgptgslnisvgakilyeavqgdkspipqavdlfagk
    pqqevvlaaledtwetlskrygnnvsnwktpamaltfrannffgvpqaaaeetrhqaeyq
    nrgtendmivfspttsdrpvlawdvvapgqsgfiapdgtvdkhyedqlkmyenfgrkslw
    ltkqdveahkesqevlhvqr