PDB entry 1e39

View 1e39 on RCSB PDB site
Description: flavocytochrome c3 from shewanella frigidimarina histidine 365 mutated to alanine
Class: oxidoreductase
Keywords: fumarate reductase mutant h365a, oxidoreductase, respiratory fumarate reductase
Deposited on 2000-06-07, released 2000-09-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.1814
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fumarate reductase flavoprotein subunit
    Species: SHEWANELLA FRIGIDIMARINA [TaxId:56812]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07WU7 (0-End)
      • engineered mutation (364)
    Domains in SCOPe 2.07: d1e39a1, d1e39a2, d1e39a3
  • Heterogens: HEC, FAD, FUM, NA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e39A (A:)
    adnlaefhvqnqecdschtpdgelsndsltyentqcvschgtlaevaettkhehynahas
    hfpgevactschsaheksmvycdschsfdfnmpyakkwlrdeptiaelakdkserqaala
    saphdtvdvvvvgsggagfsaaisatdsgakviliekepviggnaklaaggmnaawtdqq
    kakkitdspelmfedtmkggqnindpalvkvlsshskdsvdwmtamgadltdvgmmggas
    vnrahrptggagvgahvvqvlydnavkrnidlrmntrgievlkddkgtvkgilvkgmykg
    yywvkadavilatggfaknnervakldpslkgfistnqpgavgdgldvaenaggalkdmq
    yiqaaptlsvkggvmvteavrgngailvnregkrfvneittrdkasaailaqtgksayli
    fddsvrkslskidkyiglgvaptadslvklgkmegidgkaltetvarynslvssgkdtdf
    erpnlpralnegnyyaievtpgvhhtmggvmidtkaevmnakkqvipglygagevtggvh
    ganrlggnaisdiitfgrlageeaakyskkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e39A (A:)
    adnlaefhvqnqecdschtpdgelsndsltyentqcvschgtlaevaettkhehynahas
    hfpgevactschsaheksmvycdschsfdfnmpyakkwlrdeptiaelakdkserqaala
    saphdtvdvvvvgsggagfsaaisatdsgakviliekepviggnaklaaggmnaawtdqq
    kakkitdspelmfedtmkggqnindpalvkvlsshskdsvdwmtamgadltdvgmmggas
    vnrahrptggagvgahvvqvlydnavkrnidlrmntrgievlkddkgtvkgilvkgmykg
    yywvkadavilatggfaknnervakldpslkgfistnqpgavgdgldvaenaggalkdmq
    yiqaaptlsvkggvmvteavrgngailvnregkrfvneittrdkasaailaqtgksayli
    fddsvrkslskidkyiglgvaptadslvklgkmegidgkaltetvarynslvssgkdtdf
    erpnlpralnegnyyaievtpgvhhtmggvmidtkaevmnakkqvipglygagevtggvh
    ganrlggnaisdiitfgrlageeaakys