PDB entry 1e38

View 1e38 on RCSB PDB site
Description: porcine pancreatic elastase complexed with (3s, 4s)n-para-nitrobenzenesulphonyl-3-ethyl-4-(carboxylic acid)pyrrolidin-2-one soaked in ph 9 buffer for 2 minutes
Class: serine protease
Keywords: serine protease, hydrolase, serine proteinase
Deposited on 2000-06-06, released 2000-10-18
The last revision prior to the SCOP 1.75 freeze date was dated 2000-10-18, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.183
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'B':
  Compound: elastase
  Species: SUS SCROFA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00772 (0-239)
    • conflict see remark 9 (65)
  Domains in SCOP 1.75: d1e38b_
• Heterogens: CA, SO4, TPY, HOH

PDB Chain Sequences:

• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1e38B (B:)
  vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
  nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
  lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
  rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn