PDB entry 1e37

View 1e37 on RCSB PDB site
Description: porcine pancreatic elastase complexed with (3s, 4s)n-para-nitrobenzenesulphonyl-3-ethyl-4-(carboxylic acid)pyrrolidin-2-one soaked in ph 9 buffer for 1 minute
Class: hydrolase(serine protease)
Keywords: serine protease, hydrolase, serine proteinase
Deposited on 2000-06-06, released 2000-10-18
The last revision prior to the SCOP 1.73 freeze date was dated 2000-10-18, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.198
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'B':
  Compound: elastase
  Species: SUS SCROFA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00772 (0-239)
    • see remark 999 (65)
  Domains in SCOP 1.73: d1e37b_
• Heterogens: CA, SO4, TPY, HOH

PDB Chain Sequences:

• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1e37B (B:)
  vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
  nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
  lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
  rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn