PDB entry 1e35

View 1e35 on RCSB PDB site
Description: porcine pancreatic elastase complexed with (3s, 4s)n-para- toluenesulphonyl -3-ethyl-4-(carboxylic acid)pyrrolidin-2-one soaked in ph 9 buffer for two minutes
Deposited on 2000-06-06, released 2000-10-18
The last revision prior to the SCOP 1.71 freeze date was dated 2000-10-18, with a file datestamp of 2000-10-18.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.189
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Domains in SCOP 1.71: d1e35b_

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1e35B (B:)
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn