PDB entry 1e35

View 1e35 on RCSB PDB site
Description: porcine pancreatic elastase complexed with (3s, 4s)n-para-toluenesulphonyl -3-ethyl-4-(carboxylic acid)pyrrolidin-2-one soaked in ph 9 buffer for two minutes
Class: hydrolase(serine protease)
Keywords: hydrolase(serine protease), serine protease, hydrolase, serine proteinase
Deposited on 2000-06-06, released 2000-10-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'B':
  Compound: elastase
  Species: SUS SCROFA [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00772 (0-239)
    • conflict (65)
  Domains in SCOPe 2.08: d1e35b_
• Heterogens: CA, SO4, TPX, HOH

PDB Chain Sequences:

• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1e35B (B:)
  vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
  nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
  lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
  rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn