PDB entry 1e34

View 1e34 on RCSB PDB site
Description: porcine pancreatic elastase complexed with (3s, 4s)n-para-toluenesulphonyl-3-ethyl-4-(carboxylic acid) pyrrolidin-2-one soaked in ph 9 buffer for one minute
Class: hydrolase(serine protease)
Keywords: hydrolase(serine protease), serine protease, hydrolase, serine proteinase
Deposited on 2000-06-06, released 2000-10-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.19
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: elastase
    Species: SUS SCROFA [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00772 (0-239)
      • conflict see remark 9 (65)
    Domains in SCOPe 2.08: d1e34b_
  • Heterogens: CA, SO4, TPX, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e34B (B:)
    vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
    nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
    lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
    rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn