PDB entry 1e32

View 1e32 on RCSB PDB site
Description: structure of the n-terminal domain and the d1 aaa domain of membrane fusion ATPase p97
Class: ATPase
Keywords: ATPase, membrane fusion
Deposited on 2000-06-05, released 2001-05-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.224
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p97
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1e32a1, d1e32a2, d1e32a3
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e32A (A:)
    masgadskgddlstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllk
    gkkrreavcivlsddtcsdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpid
    dtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvvetdpspycivapdt
    vihcegepikredeeeslnevgyddvggcrkqlaqikemvelplrhpalfkaigvkpprg
    illygppgtgktliaravanetgaffflingpeimsklagesesnlrkafeeaeknapai
    ifideldaiapkrekthgeverrivsqlltlmdglkqrahvivmaatnrpnsidpalrrf
    grfdrevdigipdatgrleilqihtknmkladdvdleqvanethghvgadlaalcseaal
    qairkkmdlidledetidaevmnslavtmddfrwalsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e32A (A:)
    nrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsde
    kirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpyfl
    eayrpirkgdiflvrggmravefkvvetdpspycivapdtvihcegepikredeeeslne
    vgyddvggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliaravan
    etgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekthgev
    errivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrlei
    lqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetidae
    vmnslavtmddfrwalsq