PDB entry 1e32

View 1e32 on RCSB PDB site
Description:
Deposited on 2000-06-05, released 2001-05-31
The last revision prior to the SCOP 1.63 freeze date was dated 2001-05-31, with a file datestamp of 2001-05-31.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.224
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e32A (A:)
    nrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsde
    kirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpyfl
    eayrpirkgdiflvrggmravefkvvetdpspycivapdtvihcegepikredeeeslne
    vgyddvggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliaravan
    etgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekthgev
    errivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrlei
    lqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetidae
    vmnslavtmddfrwalsq