PDB entry 1e30

View 1e30 on RCSB PDB site
Description: crystal structure of the met148gln mutant of rusticyanin at 1.5 angstrom resolution
Class: rusticyanin
Keywords: rusticyanin, mutant, axial ligand, cupredoxin
Deposited on 2000-06-02, released 2000-07-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.182
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rusticyanin
    Species: THIOBACILLUS FERROOXIDANS [TaxId:920]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P74919 (Start-154)
      • cloning artifact (123)
      • engineered mutation (147)
    Domains in SCOPe 2.07: d1e30a_
  • Chain 'B':
    Compound: rusticyanin
    Species: THIOBACILLUS FERROOXIDANS [TaxId:920]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P74919 (Start-154)
      • cloning artifact (123)
      • engineered mutation (147)
    Domains in SCOPe 2.07: d1e30b_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e30A (A:)
    gtldttwkeatlpqvkamlekdtgkvsgdtvtysgktvhvvaaavlpgfpfpsfevhdkk
    nptleipagatvdvtfintnkgfghsfditkkgppyavmpvidpivagtgfspvpkdgkf
    gytnftwhptagtyyyvcqipghaatgqfgkivvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e30A (A:)
    ldttwkeatlpqvkamlekdtgkvsgdtvtysgktvhvvaaavlpgfpfpsfevhdkknp
    tleipagatvdvtfintnkgfghsfditkkgppyavmpvidpivagtgfspvpkdgkfgy
    tnftwhptagtyyyvcqipghaatgqfgkivvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e30B (B:)
    gtldttwkeatlpqvkamlekdtgkvsgdtvtysgktvhvvaaavlpgfpfpsfevhdkk
    nptleipagatvdvtfintnkgfghsfditkkgppyavmpvidpivagtgfspvpkdgkf
    gytnftwhptagtyyyvcqipghaatgqfgkivvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e30B (B:)
    ldttwkeatlpqvkamlekdtgkvsgdtvtysgktvhvvaaavlpgfpfpsfevhdkknp
    tleipagatvdvtfintnkgfghsfditkkgppyavmpvidpivagtgfspvpkdgkfgy
    tnftwhptagtyyyvcqipghaatgqfgkivvk