PDB entry 1e2y

View 1e2y on RCSB PDB site
Description: tryparedoxin peroxidase from crithidia fasciculata
Class: oxidoreductase
Keywords: 2-cys peroxiredoxin, oxidoreductase
Deposited on 2000-05-30, released 2001-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-16, with a file datestamp of 2009-06-12.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.273
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryparedoxin peroxidase
    Species: CRITHIDIA FASCICULATA [TaxId:5656]
    Gene: CF-TRYP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e2ya_
  • Chain 'B':
    Compound: tryparedoxin peroxidase
    Species: CRITHIDIA FASCICULATA [TaxId:5656]
    Gene: CF-TRYP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e2yb_
  • Chain 'C':
    Compound: tryparedoxin peroxidase
    Species: CRITHIDIA FASCICULATA [TaxId:5656]
    Gene: CF-TRYP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e2yc_
  • Chain 'D':
    Compound: tryparedoxin peroxidase
    Species: CRITHIDIA FASCICULATA [TaxId:5656]
    Gene: CF-TRYP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e2yd_
  • Chain 'E':
    Compound: tryparedoxin peroxidase
    Species: CRITHIDIA FASCICULATA [TaxId:5656]
    Gene: CF-TRYP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e2ye_
  • Chain 'F':
    Compound: tryparedoxin peroxidase
    Species: CRITHIDIA FASCICULATA [TaxId:5656]
    Gene: CF-TRYP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e2yf_
  • Chain 'G':
    Compound: tryparedoxin peroxidase
    Species: CRITHIDIA FASCICULATA [TaxId:5656]
    Gene: CF-TRYP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e2yg_
  • Chain 'H':
    Compound: tryparedoxin peroxidase
    Species: CRITHIDIA FASCICULATA [TaxId:5656]
    Gene: CF-TRYP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e2yh_
  • Chain 'I':
    Compound: tryparedoxin peroxidase
    Species: CRITHIDIA FASCICULATA [TaxId:5656]
    Gene: CF-TRYP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e2yi_
  • Chain 'J':
    Compound: tryparedoxin peroxidase
    Species: CRITHIDIA FASCICULATA [TaxId:5656]
    Gene: CF-TRYP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e2yj_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e2yA (A:)
    mscgaaklnhpapefddmalmpngtfkkvslssykgkyvvlffypmdftfvcpteiiqfs
    ddakrfaeinteviscscdseyshlqwtsvdrkkgglgpmaipmladktkaiaraygvld
    edsgvayrgvfiidpngklrqiiindmpigrnveevirlvealqfveehgevcpanwkkg
    dakkkegh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e2yA (A:)
    gaaklnhpapefddmalmpngtfkkvslssykgkyvvlffypmdftfvcpteiiqfsdda
    krfaeinteviscscdseyshlqwtsvdrkkgglgpmaipmladktkaiaraygvldeds
    gvayrgvfiidpngklrqiiindmpigrnveevirlvealqfveehg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e2yB (B:)
    mscgaaklnhpapefddmalmpngtfkkvslssykgkyvvlffypmdftfvcpteiiqfs
    ddakrfaeinteviscscdseyshlqwtsvdrkkgglgpmaipmladktkaiaraygvld
    edsgvayrgvfiidpngklrqiiindmpigrnveevirlvealqfveehgevcpanwkkg
    dakkkegh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e2yB (B:)
    aklnhpapefddmalmpngtfkkvslssykgkyvvlffypmdftfvcpteiiqfsddakr
    faeinteviscscdseyshlqwtsvdrkkgglgpmaipmladktkaiaraygvldedsgv
    ayrgvfiidpngklrqiiindmpigrnveevirlvealqfveehgevcpan
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1e2yC (C:)
    mscgaaklnhpapefddmalmpngtfkkvslssykgkyvvlffypmdftfvcpteiiqfs
    ddakrfaeinteviscscdseyshlqwtsvdrkkgglgpmaipmladktkaiaraygvld
    edsgvayrgvfiidpngklrqiiindmpigrnveevirlvealqfveehgevcpanwkkg
    dakkkegh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e2yC (C:)
    aaklnhpapefddmalmpngtfkkvslssykgkyvvlffypmdftfvcpteiiqfsddak
    rfaeinteviscscdseyshlqwtsvdrkkgglgpmaipmladktkaiaraygvldedsg
    vayrgvfiidpngklrqiiindmpigrnveevirlvealqfveehgevcp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1e2yD (D:)
    mscgaaklnhpapefddmalmpngtfkkvslssykgkyvvlffypmdftfvcpteiiqfs
    ddakrfaeinteviscscdseyshlqwtsvdrkkgglgpmaipmladktkaiaraygvld
    edsgvayrgvfiidpngklrqiiindmpigrnveevirlvealqfveehgevcpanwkkg
    dakkkegh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e2yD (D:)
    aaklnhpapefddmalmpngtfkkvslssykgkyvvlffypmdftfvcpteiiqfsddak
    rfaeinteviscscdseyshlqwtsvdrkkgglgpmaipmladktkaiaraygvldedsg
    vayrgvfiidpngklrqiiindmpigrnveevirlvealqfveehg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1e2yE (E:)
    mscgaaklnhpapefddmalmpngtfkkvslssykgkyvvlffypmdftfvcpteiiqfs
    ddakrfaeinteviscscdseyshlqwtsvdrkkgglgpmaipmladktkaiaraygvld
    edsgvayrgvfiidpngklrqiiindmpigrnveevirlvealqfveehgevcpanwkkg
    dakkkegh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e2yE (E:)
    aklnhpapefddmalmpngtfkkvslssykgkyvvlffypmdftfvcpteiiqfsddakr
    faeinteviscscdseyshlqwtsvdrkkgglgpmaipmladktkaiaraygvldedsgv
    ayrgvfiidpngklrqiiindmpigrnveevirlvealqfveehg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1e2yF (F:)
    mscgaaklnhpapefddmalmpngtfkkvslssykgkyvvlffypmdftfvcpteiiqfs
    ddakrfaeinteviscscdseyshlqwtsvdrkkgglgpmaipmladktkaiaraygvld
    edsgvayrgvfiidpngklrqiiindmpigrnveevirlvealqfveehgevcpanwkkg
    dakkkegh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e2yF (F:)
    aklnhpapefddmalmpngtfkkvslssykgkyvvlffypmdftfvcpteiiqfsddakr
    faeinteviscscdseyshlqwtsvdrkkgglgpmaipmladktkaiaraygvldedsgv
    ayrgvfiidpngklrqiiindmpigrnveevirlvealqfv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1e2yG (G:)
    mscgaaklnhpapefddmalmpngtfkkvslssykgkyvvlffypmdftfvcpteiiqfs
    ddakrfaeinteviscscdseyshlqwtsvdrkkgglgpmaipmladktkaiaraygvld
    edsgvayrgvfiidpngklrqiiindmpigrnveevirlvealqfveehgevcpanwkkg
    dakkkegh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e2yG (G:)
    aklnhpapefddmalmpngtfkkvslssykgkyvvlffypmdftfvcpteiiqfsddakr
    faeinteviscscdseyshlqwtsvdrkkgglgpmaipmladktkaiaraygvldedsgv
    ayrgvfiidpngklrqiiindmpigrnveevirlvealqfveehgevcpanwk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1e2yH (H:)
    mscgaaklnhpapefddmalmpngtfkkvslssykgkyvvlffypmdftfvcpteiiqfs
    ddakrfaeinteviscscdseyshlqwtsvdrkkgglgpmaipmladktkaiaraygvld
    edsgvayrgvfiidpngklrqiiindmpigrnveevirlvealqfveehgevcpanwkkg
    dakkkegh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e2yH (H:)
    aaklnhpapefddmalmpngtfkkvslssykgkyvvlffypmdftfvcpteiiqfsddak
    rfaeinteviscscdseyshlqwtsvdrkkgglgpmaipmladktkaiaraygvldedsg
    vayrgvfiidpngklrqiiindmpigrnveevirlvealqfveehgevc
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1e2yI (I:)
    mscgaaklnhpapefddmalmpngtfkkvslssykgkyvvlffypmdftfvcpteiiqfs
    ddakrfaeinteviscscdseyshlqwtsvdrkkgglgpmaipmladktkaiaraygvld
    edsgvayrgvfiidpngklrqiiindmpigrnveevirlvealqfveehgevcpanwkkg
    dakkkegh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e2yI (I:)
    aaklnhpapefddmalmpngtfkkvslssykgkyvvlffypmdftfvcpteiiqfsddak
    rfaeinteviscscdseyshlqwtsvdrkkgglgpmaipmladktkaiaraygvldedsg
    vayrgvfiidpngklrqiiindmpigrnveevirlvealqfveehgevcp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1e2yJ (J:)
    mscgaaklnhpapefddmalmpngtfkkvslssykgkyvvlffypmdftfvcpteiiqfs
    ddakrfaeinteviscscdseyshlqwtsvdrkkgglgpmaipmladktkaiaraygvld
    edsgvayrgvfiidpngklrqiiindmpigrnveevirlvealqfveehgevcpanwkkg
    dakkkegh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e2yJ (J:)
    aaklnhpapefddmalmpngtfkkvslssykgkyvvlffypmdftfvcpteiiqfsddak
    rfaeinteviscscdseyshlqwtsvdrkkgglgpmaipmladktkaiaraygvldedsg
    vayrgvfiidpngklrqiiindmpigrnveevirlvealqfveehg